RASD2 monoclonal antibody (M02), clone 1C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RASD2 expression in transfected 293T cell line by RASD2 monoclonal antibody (M02), clone 1C7.
Lane 1: RASD2 transfected lysate(30.4 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of RASD2 transfected lysate using anti-RASD2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RASD2 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RASD2 is 10 ng/ml as a capture antibody.
Western Blot detection against Immunogen (55 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant RASD2.
Immunogen
RASD2 (AAH13419, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIGSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RASD2 expression in transfected 293T cell line by RASD2 monoclonal antibody (M02), clone 1C7.
Lane 1: RASD2 transfected lysate(30.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of RASD2 transfected lysate using anti-RASD2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RASD2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RASD2 is 10 ng/ml as a capture antibody.ELISA
-
Gene Info — RASD2
Entrez GeneID
23551GeneBank Accession#
BC013419Protein Accession#
AAH13419Gene Name
RASD2
Gene Alias
MGC:4834, Rhes, TEM2
Gene Description
RASD family, member 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a Ras-related protein that enriched in striatum. The product of this gene binds to GTP and possesses intrinsic GTPase activity. The gene belongs to the Ras superfamily of small GTPases. The exact function of this gene is unknown, but most striatum-specific mRNAs characterized to date encode components of signal transduction cascades. [provided by RefSeq
Other Designations
GTP-binding protein Rhes|Ras homolog enriched in striatum|tumor endothelial marker 2
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com