RASD2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RASD2 expression in transfected 293T cell line (H00023551-T01) by RASD2 MaxPab polyclonal antibody.
Lane 1: RASD2 transfected lysate(29.26 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RASD2 protein.
Immunogen
RASD2 (NP_055125.2, 1 a.a. ~ 266 a.a) full-length human protein.
Sequence
MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RASD2 expression in transfected 293T cell line (H00023551-T01) by RASD2 MaxPab polyclonal antibody.
Lane 1: RASD2 transfected lysate(29.26 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RASD2
Entrez GeneID
23551GeneBank Accession#
NM_014310Protein Accession#
NP_055125.2Gene Name
RASD2
Gene Alias
MGC:4834, Rhes, TEM2
Gene Description
RASD family, member 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a Ras-related protein that enriched in striatum. The product of this gene binds to GTP and possesses intrinsic GTPase activity. The gene belongs to the Ras superfamily of small GTPases. The exact function of this gene is unknown, but most striatum-specific mRNAs characterized to date encode components of signal transduction cascades. [provided by RefSeq
Other Designations
GTP-binding protein Rhes|Ras homolog enriched in striatum|tumor endothelial marker 2
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com