ATP6V0A2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ATP6V0A2 partial ORF ( NP_036595, 198 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVIQVKK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.51
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ATP6V0A2
Entrez GeneID
23545GeneBank Accession#
NM_012463Protein Accession#
NP_036595Gene Name
ATP6V0A2
Gene Alias
ARCL, ATP6N1D, ATP6a2, J6B7, Stv1, TJ6, TJ6M, TJ6s, Vph1, WSS, a2
Gene Description
ATPase, H+ transporting, lysosomal V0 subunit a2
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the vacuolar ATPase (v-ATPase), an heteromultimeric enzyme that is present in intracellular vesicles and in the plasma membrane of specialized cells, and which is essential for the acidification of diverse cellular components. V-ATPase is comprised of a membrane peripheral V(1) domain for ATP hydrolysis, and an integral membrane V(0) domain for proton translocation. The subunit encoded by this gene is a component of the V(0) domain. Mutations in this gene are a cause of both cutis laxa type II and wrinkly skin syndrome. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal V0 subunit A2|infantile malignant osteopetrosis
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com