RBM9 monoclonal antibody (M02), clone 5E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RBM9.
Immunogen
RBM9 (AAH13115, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RBM9 monoclonal antibody (M02), clone 5E11. Western Blot analysis of RBM9 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
RBM9 monoclonal antibody (M02), clone 5E11 Western Blot analysis of RBM9 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RBM9 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RBM9 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — RBM9
Entrez GeneID
23543GeneBank Accession#
BC013115Protein Accession#
AAH13115Gene Name
RBM9
Gene Alias
FOX2, Fox-2, HNRBP2, HRNBP2, RTA, dJ106I20.3, fxh
Gene Description
RNA binding motif protein 9
Gene Ontology
HyperlinkGene Summary
This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000028771|fox-1 homologue|hexaribonucleotide binding protein 2|repressor of tamoxifen transcriptional activity
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com