RBM9 monoclonal antibody (M01J), clone 4G3

Catalog # H00023543-M01J

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 428.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RBM9 monoclonal antibody (M01J), clone 4G3. Western Blot analysis of RBM9 expression in NIH/3T3.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibody (M01J), clone 4G3.

Lane 1: RBM9 transfected lysate (Predicted MW: 40.4 KDa).
Lane 2: Non-transfected lysate.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged RBM9 is 1 ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi ( Cat # H00023543-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody (M01), clone 4G3 (Cat # H00023543-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Immunofluorescence
Application

Immunofluorescence

Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell . [antibody concentration 10 ug/ml]

QC Test

Western Blot detection against Immunogen (36.63 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant RBM9.
    This product is belong to Cell Culture Grade Antibody (CX Grade).Cell Culture Grade Antibody,Cell Culture Grade Antibodies,Cell Culture Grade,CX Grade,CXGrade

    Immunogen

    RBM9 (AAH13115, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS

    Host

    Mouse

    Reactivity

    Human, Mouse

    Interspecies Antigen Sequence

    Mouse (98); Rat (98)

    Preparation Method

    Cell Culture Production

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.63 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    RBM9 monoclonal antibody (M01J), clone 4G3. Western Blot analysis of RBM9 expression in NIH/3T3.

    Western Blot (Transfected lysate)

    Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibody (M01J), clone 4G3.

    Lane 1: RBM9 transfected lysate (Predicted MW: 40.4 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged RBM9 is 1 ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi ( Cat # H00023543-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody (M01), clone 4G3 (Cat # H00023543-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

    Immunofluorescence

    Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell . [antibody concentration 10 ug/ml]
  • Gene Info — RBM9

    Entrez GeneID

    23543

    GeneBank Accession#

    BC013115

    Protein Accession#

    AAH13115

    Gene Name

    RBM9

    Gene Alias

    FOX2, Fox-2, HNRBP2, HRNBP2, RTA, dJ106I20.3, fxh

    Gene Description

    RNA binding motif protein 9

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    OTTHUMP00000028771|fox-1 homologue|hexaribonucleotide binding protein 2|repressor of tamoxifen transcriptional activity

  • Interactome
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All