Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MACF1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00023499-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MACF1 partial ORF ( AAH07330, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.08
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023499-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MACF1
  • Gene Alias:
  • ABP620,ACF7,FLJ45612,FLJ46776,KIAA0465,KIAA1251,MACF,OFC4
  • Gene Description:
  • microtubule-actin crosslinking factor 1
  • Gene Summary:
  • The protein encoded by this gene belongs to the plakin family of cytoskeletal linker proteins. This protein family forms bridges between different cytoskeletal elements through specialized modular domains. The encoded protein is one of the largest size proteins identified in human cytoskeletal proteins. It has functional actin and microtubule binding domains, and it appears to stabilize actin at sites where microtubules and microfilaments meet. It may function in microtubule dynamics to facilitate actin-microtubule interactions at the cell periphery and to couple the microtubule network to cellular junctions. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • 620 kDa actin binding protein,OTTHUMP00000009301,OTTHUMP00000009303,actin cross-linking factor,actin cross-linking family protein 7,macrophin 1,microfilament and actin filament cross-linker protein,trabeculin-alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook