MACF1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a partial recombinant MACF1.
Immunogen
MACF1 (AAH07330, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
Sequence
KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.45 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — MACF1
Entrez GeneID
23499GeneBank Accession#
BC007330Protein Accession#
AAH07330Gene Name
MACF1
Gene Alias
ABP620, ACF7, FLJ45612, FLJ46776, KIAA0465, KIAA1251, MACF, OFC4
Gene Description
microtubule-actin crosslinking factor 1
Omim ID
608271Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the plakin family of cytoskeletal linker proteins. This protein family forms bridges between different cytoskeletal elements through specialized modular domains. The encoded protein is one of the largest size proteins identified in human cytoskeletal proteins. It has functional actin and microtubule binding domains, and it appears to stabilize actin at sites where microtubules and microfilaments meet. It may function in microtubule dynamics to facilitate actin-microtubule interactions at the cell periphery and to couple the microtubule network to cellular junctions. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
620 kDa actin binding protein|OTTHUMP00000009301|OTTHUMP00000009303|actin cross-linking factor|actin cross-linking family protein 7|macrophin 1|microfilament and actin filament cross-linker protein|trabeculin-alpha
-
Interactomes
-
Diseases
-
Publication Reference
-
Focal adhesions contain three specialized actin nanoscale layers.
Reena Kumari, Katharina Ven, Megan Chastney, Shrikant B Kokate, Johan Peränen, Jesse Aaron, Konstantin Kogan, Leonardo Almeida-Souza, Elena Kremneva, Renaud Poincloux, Teng-Leong Chew, Peter W Gunning, Johanna Ivaska, Pekka Lappalainen.
Nature Communications 2024 Mar; 15(1):2547.
Application:N/A, N/A, N/A.
-
Quantitative protein and mRNA profiling shows selective post-transcriptional control of protein expression by vasopressin in kidney cells.
Khositseth S, Pisitkun T, Slentz DH, Wang G, Hoffert JD, Knepper MA, Yu MJ.
Molecular & Cellular Proteomics 2011 Jan; 10(1):M110.00403.
Application:WB-Tr, Human, HEp-2 cells.
-
Focal adhesions contain three specialized actin nanoscale layers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com