Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MACF1 polyclonal antibody (A01)

  • Catalog # : H00023499-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MACF1.
  • Immunogen:
  • MACF1 (AAH07330, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023499-A01
    Western Blot detection against Immunogen (36.45 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • MACF1
  • Gene Alias:
  • ABP620,ACF7,FLJ45612,FLJ46776,KIAA0465,KIAA1251,MACF,OFC4
  • Gene Description:
  • microtubule-actin crosslinking factor 1
  • Gene Summary:
  • The protein encoded by this gene belongs to the plakin family of cytoskeletal linker proteins. This protein family forms bridges between different cytoskeletal elements through specialized modular domains. The encoded protein is one of the largest size proteins identified in human cytoskeletal proteins. It has functional actin and microtubule binding domains, and it appears to stabilize actin at sites where microtubules and microfilaments meet. It may function in microtubule dynamics to facilitate actin-microtubule interactions at the cell periphery and to couple the microtubule network to cellular junctions. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • 620 kDa actin binding protein,OTTHUMP00000009301,OTTHUMP00000009303,actin cross-linking factor,actin cross-linking family protein 7,macrophin 1,microfilament and actin filament cross-linker protein,trabeculin-alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook