Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF13B monoclonal antibody (M20), clone 1F5

  • Catalog # : H00023495-M20
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TNFRSF13B.
  • Immunogen:
  • TNFRSF13B (NP_036584.1, 2 a.a. ~ 165 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023495-M20
    Western Blot detection against Immunogen (20.24 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TNFRSF13B
  • Gene Alias:
  • CD267,CVID,FLJ39942,MGC133214,MGC39952,TACI,TNFRSF14B
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 13B
  • Gene Summary:
  • The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000065442,transmembrane activator and CAML interactor,tumor necrosis factor receptor 13B
  • RSS
  • YouTube
  • Linkedin
  • Facebook