Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NIFUN (Human) Recombinant Protein (P01)

  • Catalog # : H00023479-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NIFUN full-length ORF ( AAH11906, 26 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 41.36
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023479-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ISCU
  • Gene Alias:
  • 2310020H20Rik,HML,ISU2,MGC74517,NIFU,NIFUN,hnifU
  • Gene Description:
  • iron-sulfur cluster scaffold homolog (E. coli)
  • Gene Summary:
  • Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria. [provided by RefSeq
  • Other Designations:
  • IscU iron-sulfur cluster scaffold homolog,NifU-like N-terminal domain containing,iron-sulfur cluster assembly enzyme,nitrogen fixation cluster-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook