CBX5 monoclonal antibody (M01), clone 1E11-3A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CBX5 monoclonal antibody (M01), clone 1E11-3A10 Western Blot analysis of CBX5 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of CBX5 expression in transfected 293T cell line by CBX5 monoclonal antibody (M01), clone 1E11-3A10.
Lane 1: CBX5 transfected lysate(22.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CBX5 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CBX5 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (46.75 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CBX5.
Immunogen
CBX5 (AAH06821, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (46.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CBX5 monoclonal antibody (M01), clone 1E11-3A10 Western Blot analysis of CBX5 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of CBX5 expression in transfected 293T cell line by CBX5 monoclonal antibody (M01), clone 1E11-3A10.
Lane 1: CBX5 transfected lysate(22.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CBX5 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CBX5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CBX5
Entrez GeneID
23468GeneBank Accession#
BC006821Protein Accession#
AAH06821Gene Name
CBX5
Gene Alias
HP1, HP1A
Gene Description
chromobox homolog 5 (HP1 alpha homolog, Drosophila)
Omim ID
604478Gene Ontology
HyperlinkGene Summary
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
HP1-ALPHA|HP1Hs alpha|antigen p25|heterochromatin protein 1 homolog alpha|heterochromatin protein 1-alpha
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com