CBX5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CBX5 protein.
Immunogen
CBX5 (NP_036249.1, 1 a.a. ~ 191 a.a) full-length human protein.
Sequence
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CBX5 MaxPab polyclonal antibody. Western Blot analysis of CBX5 expression in IMR-32.Western Blot (Cell lysate)
CBX5 MaxPab polyclonal antibody. Western Blot analysis of CBX5 expression in C32.Western Blot (Transfected lysate)
Western Blot analysis of CBX5 expression in transfected 293T cell line (H00023468-T01) by CBX5 MaxPab polyclonal antibody.
Lane 1: CBX5 transfected lysate(21.01 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CBX5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CBX5
Entrez GeneID
23468GeneBank Accession#
NM_012117.1Protein Accession#
NP_036249.1Gene Name
CBX5
Gene Alias
HP1, HP1A
Gene Description
chromobox homolog 5 (HP1 alpha homolog, Drosophila)
Omim ID
604478Gene Ontology
HyperlinkGene Summary
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
HP1-ALPHA|HP1Hs alpha|antigen p25|heterochromatin protein 1 homolog alpha|heterochromatin protein 1-alpha
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com