Product Browser

Last updated: 2017/4/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ICMT polyclonal antibody (A01)

  • Catalog # : H00023463-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ICMT.
  • Immunogen:
  • ICMT (NP_036537, 86 a.a. ~ 154 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023463-A01
    Western Blot detection against Immunogen (33.7 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ICMT
  • Gene Alias:
  • HSTE14,MGC39955,MST098,MSTP098,PCCMT,PCMT,PPMT
  • Gene Description:
  • isoprenylcysteine carboxyl methyltransferase
  • Gene Summary:
  • This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000001381,prenylated protein carboxyl methyltransferase,prenylcysteine carboxyl methyltransferase,protein-S isoprenylcysteine O-methyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook