HEY1 monoclonal antibody (M02), clone 2F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HEY1.
Immunogen
HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HEY1 expression in transfected 293T cell line by HEY1 monoclonal antibody (M02), clone 2F10.
Lane 1: HEY1 transfected lysate(32.613 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HEY1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — HEY1
Entrez GeneID
23462GeneBank Accession#
NM_012258Protein Accession#
NP_036390Gene Name
HEY1
Gene Alias
BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1
Gene Description
hairy/enhancer-of-split related with YRPW motif 1
Omim ID
602953Gene Ontology
HyperlinkGene Summary
This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
HES-related repressor protein 2|basic helix-loop-helix protein OAF1|cardiovascular helix-loop-helix factor 2|hairy-related transcription factor 1
-
Interactome
-
Publication Reference
-
Notch Intracellular Domain Plasmid Delivery via Poly(Lactic-Co-Glycolic Acid) Nanoparticles to Upregulate Notch Pathway Molecules.
Victoria L Messerschmidt, Uday Chintapula, Aneetta E Kuriakose, Samantha Laboy, Thuy Thi Dang Truong, LeNaiya A Kydd, Justyn Jaworski, Zui Pan, Hashem Sadek, Kytai T Nguyen, Juhyun Lee.
Frontiers in Cardiovascular Medicine 2021 Sep; 8:707897.
Application:WB, Human, HUVEC cells.
-
Role of HERP and a HERP-related protein in HRD1-dependent protein degradation at the endoplasmic reticulum.
Huang CH, Chu YR, Ye Y, Chen X.
The Journal of Biological Chemistry 2014 Feb; 289(7):4444.
Application:WB, Human, 293T cells.
-
Notch Intracellular Domain Plasmid Delivery via Poly(Lactic-Co-Glycolic Acid) Nanoparticles to Upregulate Notch Pathway Molecules.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com