SF3B3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SF3B3 partial ORF ( NP_036558.3, 819 a.a. - 929 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.95
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SF3B3
Entrez GeneID
23450GeneBank Accession#
NM_012426Protein Accession#
NP_036558.3Gene Name
SF3B3
Gene Alias
KIAA0017, RSE1, SAP130, SF3b130, STAF130
Gene Description
splicing factor 3b, subunit 3, 130kDa
Omim ID
605592Gene Ontology
HyperlinkGene Summary
This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair. [provided by RefSeq
Other Designations
pre-mRNA splicing factor SF3b, 130 kDa subunit|spliceosome-associated protein 130|splicing factor 3b, subunit 3
-
Interactome
-
Disease
-
Publication Reference
-
SAP130 released by damaged tubule drives necroinflammation via miRNA-219c/Mincle signaling in acute kidney injury.
Lin-Li Lv, Cui Wang, Zuo-Lin Li, Jing-Yuan Cao, Xin Zhong, Ye Feng, Jun Chen, Tao-Tao Tang, Hai-Feng Ni, Qiu-Li Wu, Bin Wang, Hui-Yao Lan, Bi-Cheng Liu.
Cell Death & Disease 2021 Sep; 12(10):866.
Application：Func, Mouse, Mouse tail intravenous injection.
-
Microglial Mincle receptor in the PVN contributes to sympathetic hyperactivity in acute myocardial infarction rat.
Wang Y, Yin J, Wang C, Hu H, Li X, Xue M, Liu J, Cheng W, Wang Y, Li Y, Shi Y, Tan J, Li X, Liu F, Liu Q, Yan S.
Journal of Cellular and Molecular Medicine 2019 Jan; 23(1):112.
Application：Func, Rat, Rat Mouse serum.
-
Human albumin attenuates excessive innate immunity via inhibition of microglial Mincle/Syk signaling in subarachnoid hemorrhage.
Xie Y, Guo H, Wang L, Xu L, Zhang X, Yu L, Liu Q, Li Y, Zhao N, Zhao N, Ye R, Liu X.
Brain, Behavior, and Immunity 2017 Feb; 60:346.
Application：ELISA, Func, IF, WB, Rat, BV-2 microglial cell line.
-
SAP130 released by damaged tubule drives necroinflammation via miRNA-219c/Mincle signaling in acute kidney injury.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com