Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HARSL polyclonal antibody (A01)

  • Catalog # : H00023438-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HARSL.
  • Immunogen:
  • HARSL (NP_036340, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023438-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HARSL polyclonal antibody (A01), Lot # 060124JC01. Western Blot analysis of HARSL expression in Daoy.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • HARS2
  • Gene Alias:
  • HARSL,HARSR,HO3
  • Gene Description:
  • histidyl-tRNA synthetase 2, mitochondrial (putative)
  • Gene Summary:
  • Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is an enzyme belonging to the class II family of aminoacyl-tRNA synthetases. Functioning in the synthesis of histidyl-transfer RNA, the enzyme plays an accessory role in the regulation of protein biosynthesis. The gene is located in a head-to-head orientation with HARS on chromosome five, where the homologous genes share a bidirectional promoter. [provided by RefSeq
  • Other Designations:
  • HARS-related,hisRS,histidine tRNA ligase 2, mitochondrial (putative),histidine translase,histidine-tRNA ligase homolog,histidyl-tRNA synthetase 2,histidyl-tRNA synthetase-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook