TARDBP (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TARDBP partial ORF (NP_031401.1, 1 a.a. - 260 a.a.) recombinant protein with GST tag at N-terminal.
Sequence
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
54.34
Interspecies Antigen Sequence
Mouse (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TARDBP
Entrez GeneID
23435GeneBank Accession#
NM_007375.3Protein Accession#
NP_031401.1Gene Name
TARDBP
Gene Alias
ALS10, TDP-43
Gene Description
TAR DNA binding protein
Omim ID
605078Gene Ontology
HyperlinkGene Summary
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq
Other Designations
OTTHUMP00000002171|TAR DNA-binding protein-43
-
Interactome
-
Disease
-
Publication Reference
-
Improved detection of prostate cancer using a magneto-nanosensor assay for serum circulating autoantibodies.
Xu L, Lee JR, Hao S, Ling XB, Brooks JD, Wang SX, Gambhir SS.
PLoS One 2019 Aug; 14(8):e0221051.
Application:Func, Human, As a standard, Human serum.
-
Muscle-dominant wild-type TDP-43 expression induces myopathological changes featuring tubular aggregates and TDP-43-positive inclusions.
Tawara N, Yamashita S, Kawakami K, Kurashige T, Zhang Z, Tasaki M, Yamamoto Y, Nishikami T, Doki T, Zhang X, Matsuo Y, Kimura E, Tawara A, Maeda Y, Hauschka SD, Maruyama H, Ando Y.
Experimental Neurology 2018 Nov; 309:169.
Application:Treated, Mouse, C2C12 cells.
-
Homozygosity for the C9orf72 GGGGCC repeat expansion in frontotemporal dementia.
Fratta P, Poulter M, Lashley T, Rohrer JD, Polke JM, Beck J, Ryan N, Hensman D, Mizielinska S, Waite AJ, Lai MC, Gendron TF, Petrucelli L, Fisher EM, Revesz T, Warren JD, Collinge J, Isaacs AM, Mead S.
Acta Neuropathologica 2013 Sep; 126(3):401.
Application:IHC, Human, Human brains.
-
Clinical and neuroanatomical signatures of tissue pathology in frontotemporal lobar degeneration.
Rohrer JD, Lashley T, Schott JM, Warren JE, Mead S, Isaacs AM, Beck J, Hardy J, de Silva R, Warrington E, Troakes C, Al-Sarraj S, King A, Borroni B, Clarkson MJ, Ourselin S, Holton JL, Fox NC, Revesz T, Rossor MN, Warren JD.
Brain 2011 Sep; 134(Pt 9):2565.
Application:IHC, Human, Brain.
-
Development of a novel nonradiometric assay for nucleic acid binding to TDP-43 suitable for high-throughput screening using AlphaScreen technology.
Cassel JA, Blass BE, Reitz AB, Pawlyk AC.
Journal of Biomolecular Screening 2010 Oct; 15(9):1099.
Application:Incubated, Recombinant protein.
-
Improved detection of prostate cancer using a magneto-nanosensor assay for serum circulating autoantibodies.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com