Product Browser

Last updated: 2022/6/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TARDBP monoclonal antibody (M01), clone 2E2-D3 

  • Catalog # : H00023435-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TARDBP.
  • Immunogen:
  • TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023435-M01
    Western Blot detection against Immunogen (54.34 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (96)
  • Publication Reference
  • 3.
  • Homozygous R136S mutation in PRNP gene causes inherited early onset prion disease.
    Teresa Ximelis, Alba Marín-Moreno, Juan Carlos Espinosa, Hasier Eraña, Jorge M Charco, Isabel Hernández, Carmen Riveira, Daniel Alcolea, Eva González-Roca, Iban Aldecoa, Laura Molina-Porcel, Piero Parchi, Marcello Rossi, Joaquín Castilla, Raquel Ruiz-García, Ellen Gelpi, Juan María Torres, Raquel Sánchez-Valle.Alzheimers Res Ther. 2021 Oct 18;13(1):176. doi: 10.1186/s13195-021-00912-6.
  • 14.
  • BraInMap Elucidates the Macromolecular Connectivity Landscape of Mammalian Brain.
    Reza Pourhaghighi, Peter E A Ash, Sadhna Phanse, Florian Goebels, Lucas Z M Hu, Siwei Chen, Yingying Zhang, Shayne D Wierbowski, Samantha Boudeau, Mohamed T Moutaoufik, Ramy H Malty, Edyta Malolepsza, Kalliopi Tsafou, Aparna Nathan, Graham Cromar, Hongbo Guo, Ali Al Abdullatif, Daniel J Apicco, Lindsay A Becker, Aaron D Gitler, Stefan M Pulst, Ahmed Youssef, Ryan Hekman, Pierre C Havugimana, Carl A White, Benjamin C Blum, Antonia Ratti, Camron D Bryant, John Parkinson, Kasper Lage, Mohan Babu, HCell Syst. 2020 Apr 22;10(4):333-350.e14. doi: 10.1016/j.cels.2020.03.003.
  • 24.
  • MAPT p.V363I mutation: A rare cause of corticobasal degeneration.
    Ahmed S, Fairen MD, Sabir MS, Pastor P, Ding J, Ispierto L, Butala A, Morris CM, Schulte C, Gasser T, Jabbari E, Pletnikova O, Morris HR, Troncoso J, Gelpi E, Pantelyat A, Scholz SW.Neurol Genet. 2019 Jun 25;5(4):e347. doi: 10.1212/NXG.0000000000000347. eCollection 2019 Aug.
  • 54.
  • TBK1 Mutation Spectrum in an Extended European Patient Cohort With Frontotemporal Dementia and Amyotrophic Lateral Sclerosis.
    van der Zee J,Gijselinck I,Van Mossevelde S,Perrone F,Dillen L,Heeman B,Bäumer V,Engelborghs S,De Bleecker J,Baets J,Gelpi E,Rojas-García R,Clarimón J,Lleó A,Diehl-Schmid J,Alexopoulos P, Perneczky R,Synofzik M,Just J,Schöls L,Graff C,Thonberg H,Borroni B,Padovani A,Jordanova A,Sarafov S,Tournev I,de Mendonça A,Miltenberger-Miltényi G,Simões do Couto F,Ramirez A,Jessen F,Heneka MT,Gómez-Tortosa E,Danek A,Cras P,Vandenberghe R,De Jonghe P,De Deyn PP,Sleegers K,Cruts M,Van Broeckhoven C,Goeman J.Hum Mutat. 2016 Dec 23. [Epub ahead of print]
  • 58.
  • Neuropathological criteria of anti-IgLON5-related tauopathy.
    Gelpi E, Hoftberger R, Graus F, Ling H, Holton JL, Dawson T, Popovic M, Pretnar-Oblak J, Hogl B, Schmutzhard E, Poewe W, Ricken G, Santamaria J, Dalmau J, Budka H, Revesz T, Kovacs GG.Acta Neuropathol. 2016 Jun 29. [Epub ahead of print]
  • 139.
  • Mutations of optineurin in amyotrophic lateral sclerosis.
    Maruyama H, Morino H, Ito H, Izumi Y, Kato H, Watanabe Y, Kinoshita Y, Kamada M, Nodera H, Suzuki H, Komure O, Matsuura S, Kobatake K, Morimoto N, Abe K, Suzuki N, Aoki M, Kawata A, Hirai T, Kato T, Ogasawara K, Hirano A, Takumi T, Kusaka H, Hagiwara K, Kaji R, Kawakami H.Nature. 2010 May 13;465(7295):223-6. Epub 2010 Apr 28.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TARDBP monoclonal antibody (M01), clone 2E2-D3 Western Blot analysis of TARDBP expression in A-431 ( Cat # L015V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TARDBP expression in transfected 293T cell line by TARDBP monoclonal antibody (M01), clone 2E2-D3.

    Lane 1: TARDBP transfected lysate(44.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence
  • Immunofluorescence enlargeenlarge this image
  • Immunofluorescence of monoclonal antibody to TARDBP on HeLa cell. [antibody concentration 10 ug/ml]
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to TARDBP on formalin-fixed paraffin-embedded human leiomyosarcoma tissue [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of TARDBP transfected lysate using anti-TARDBP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TARDBP MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged TARDBP is 0.3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of TARDBP over-expressed 293 cell line, cotransfected with TARDBP Validated Chimera RNAi ( Cat # H00023435-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TARDBP monoclonal antibody (M01), clone 2E2-D3 (Cat # H00023435-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Gene Name:
  • TARDBP
  • Gene Alias:
  • ALS10,TDP-43
  • Gene Description:
  • TAR DNA binding protein
  • Gene Summary:
  • HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000002171,TAR DNA-binding protein-43
  • RSS
  • YouTube
  • Linkedin
  • Facebook