SIRT1 monoclonal antibody (M01), clone 7B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SIRT1 monoclonal antibody (M01), clone 7B7 Western Blot analysis of SIRT1 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SIRT1 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIRT1 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SIRT1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SIRT1.
Immunogen
SIRT1 (AAH12499, 456 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SIRT1 monoclonal antibody (M01), clone 7B7 Western Blot analysis of SIRT1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SIRT1 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIRT1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SIRT1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SIRT1
Entrez GeneID
23411GeneBank Accession#
BC012499Protein Accession#
AAH12499Gene Name
SIRT1
Gene Alias
SIR2L1
Gene Description
sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
Omim ID
604479Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000019691|OTTHUMP00000060745|SIR2alpha|sir2-like 1|sirtuin 1|sirtuin type 1
-
Interactome
-
Disease
-
Publication Reference
-
Simvastatin inhibits Cyr61 expression in rheumatoid arthritis synovial fibroblasts through the regulation of SIRT1/FoxO3a signaling.
Kok SH, Lin LD, Hou KL, Hong CY, Chang CC, Hsiao M, Wang JH, Lai EH, Lin SK.
Arthritis and Rheumatism 2013 Mar; 65(3):639.
Application：WB, Human, Rheumatoid arthritis synovial fibroblasts (RASFs).
-
Remodeling of ribosomal genes in somatic cells by Xenopus egg extract.
Ostrup O, Hyttel P, Klarke DA, Collas P.
Biochemical and Biophysical Research Communications 2011 Sep; 412(3):487.
Application：ChIP, Frog, Frog egg extracts.
-
Identification of DBC1 as a transcriptional repressor for BRCA1.
Hiraike H, Wada-Hiraike O, Nakagawa S, Koyama S, Miyamoto Y, Sone K, Tanikawa M, Tsuruga T, Nagasaka K, Matsumoto Y, Oda K, Shoji K, Fukuhara H, Saji S, Nakagawa K, Kato S, Yano T, Taketani Y.
British Journal of Cancer 2010 Mar; 102(6):1061.
Application：WB-Tr, Human, HeLa cells.
-
Simvastatin inhibits Cyr61 expression in rheumatoid arthritis synovial fibroblasts through the regulation of SIRT1/FoxO3a signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com