Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SIRT3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00023410-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SIRT3 partial ORF ( NP_036371.1, 297 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.07
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023410-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SIRT3
  • Gene Alias:
  • SIR2L3
  • Gene Description:
  • sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq
  • Other Designations:
  • mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase,silent mating type information regulation 2, S.cerevisiae, homolog 3,sir2-like 3,sirtuin 3,sirtuin type 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook