SIRT3 monoclonal antibody (M09), clone 1A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SIRT3 expression in transfected 293T cell line by SIRT3 monoclonal antibody (M09), clone 1A4.
Lane 1: SIRT3 transfected lysate (Predicted MW: 28.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIRT3 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SIRT3.
Immunogen
SIRT3 (NP_036371.1, 297 a.a. ~ 399 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (85)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SIRT3 expression in transfected 293T cell line by SIRT3 monoclonal antibody (M09), clone 1A4.
Lane 1: SIRT3 transfected lysate (Predicted MW: 28.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIRT3 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — SIRT3
Entrez GeneID
23410GeneBank Accession#
NM_012239Protein Accession#
NP_036371.1Gene Name
SIRT3
Gene Alias
SIR2L3
Gene Description
sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
Omim ID
604481Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq
Other Designations
mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase|silent mating type information regulation 2, S.cerevisiae, homolog 3|sir2-like 3|sirtuin 3|sirtuin type 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com