SIRT4 monoclonal antibody (M03), clone 1C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIRT4 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SIRT4.
Immunogen
SIRT4 (NP_036372.1, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (87); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIRT4 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — SIRT4
Entrez GeneID
23409GeneBank Accession#
NM_012240Protein Accession#
NP_036372.1Gene Name
SIRT4
Gene Alias
MGC130046, MGC130047, MGC57437, SIR2L4
Gene Description
sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
Omim ID
604482Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family. [provided by RefSeq
Other Designations
sir2-like 4|sirtuin 4|sirtuin type 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com