Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DICER1 monoclonal antibody (M01A), clone 2F12

  • Catalog # : H00023405-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DICER1.
  • Immunogen:
  • DICER1 (NP_803187, 1813 a.a. ~ 1912 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023405-M01A
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DICER1
  • Gene Alias:
  • DCR1,Dicer,HERNA,KIAA0928
  • Gene Description:
  • dicer 1, ribonuclease type III
  • Gene Summary:
  • This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • Dicer1, Dcr-1 homolog,K12H4.8-LIKE,dicer 1, double-stranded RNA-specific endoribonuclease,dicer1,helicase with RNAse motif,helicase-moi
  • RSS
  • YouTube
  • Linkedin
  • Facebook