Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BRRN1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00023397-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BRRN1 partial ORF ( AAH24211, 645 a.a. - 741 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.30
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023397-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NCAPH
  • Gene Alias:
  • BRRN1,CAP-H,HCAP-H
  • Gene Description:
  • non-SMC condensin I complex, subunit H
  • Gene Summary:
  • This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization. [provided by RefSeq
  • Other Designations:
  • XCAP-H homolog,barren homolog 1,chromosome-associated protein H,condensin complex subunit 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook