BRRN1 monoclonal antibody (M01), clone 1C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BRRN1 monoclonal antibody (M01), clone 1C9 Western Blot analysis of BRRN1 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of NCAPH expression in transfected 293T cell line by NCAPH monoclonal antibody (M01), clone 1C9.
Lane 1: NCAPH transfected lysate (Predicted MW: 82.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BRRN1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.3 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BRRN1.
Immunogen
BRRN1 (AAH24211, 645 a.a. ~ 741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BRRN1 monoclonal antibody (M01), clone 1C9 Western Blot analysis of BRRN1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NCAPH expression in transfected 293T cell line by NCAPH monoclonal antibody (M01), clone 1C9.
Lane 1: NCAPH transfected lysate (Predicted MW: 82.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BRRN1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — NCAPH
Entrez GeneID
23397GeneBank Accession#
BC024211Protein Accession#
AAH24211Gene Name
NCAPH
Gene Alias
BRRN1, CAP-H, HCAP-H
Gene Description
non-SMC condensin I complex, subunit H
Omim ID
602332Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization. [provided by RefSeq
Other Designations
XCAP-H homolog|barren homolog 1|chromosome-associated protein H|condensin complex subunit 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com