NCSTN polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NCSTN polyclonal antibody (A01), Lot # 051214JC01. Western Blot analysis of NCSTN expression in NIH/3T3.
Western Blot (Cell lysate)
NCSTN polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of NCSTN expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant NCSTN.
Immunogen
NCSTN (AAH47621, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag.
Sequence
VERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NCSTN polyclonal antibody (A01), Lot # 051214JC01. Western Blot analysis of NCSTN expression in NIH/3T3.Western Blot (Cell lysate)
NCSTN polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of NCSTN expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — NCSTN
Entrez GeneID
23385GeneBank Accession#
BC047621Protein Accession#
AAH47621Gene Name
NCSTN
Gene Alias
APH2, KIAA0253
Gene Description
nicastrin
Omim ID
605254Gene Ontology
HyperlinkGene Summary
This gene encodes a Type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may be a stabilizing cofactor required for gamma-secretase complex assembly. The cleavage of beta-amyloid precursor protein yields amyloid beta peptide, the main component of the neuritic plaque and the hallmark lesion in the brains of patients with Alzheimer's disease; however, the nature of the encoded protein's role in Alzheimer's disease is not known for certain. Alternatively spliced transcript variants have been described, but their full-length nature has not been determined. [provided by RefSeq
Other Designations
ATAG1874|OTTHUMP00000031839|anterior pharynx-defective 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com