ARHGEF18 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ARHGEF18 full-length ORF ( AAH08016.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.8
Interspecies Antigen Sequence
Mouse (33); Rat (42)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ARHGEF18
Entrez GeneID
23370GeneBank Accession#
BC008016.1Protein Accession#
AAH08016.1Gene Name
ARHGEF18
Gene Alias
KIAA0521, MGC15913, P114-RhoGEF
Gene Description
rho/rac guanine nucleotide exchange factor (GEF) 18
Gene Ontology
HyperlinkGene Summary
Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
P114-RHO-GEF|Rho-specific guanine nucleotide exchange factor p114
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com