Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PUM2 monoclonal antibody (M16), clone 4G12

  • Catalog # : H00023369-M16
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant PUM2.
  • Immunogen:
  • PUM2 (NP_056132, 106 a.a. ~ 205 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KLDSRFRKGNFGTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQASPTEVVERLGPNTNPSEGLGPLPN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023369-M16
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PUM2
  • Gene Alias:
  • FLJ36528,KIAA0235,MGC138251,MGC138253,PUMH2,PUML2
  • Gene Description:
  • pumilio homolog 2 (Drosophila)
  • Other Designations:
  • OTTHUMP00000151186,pumilio homolog 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook