Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ICOSLG (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00023308-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified ICOSLG (AAH64637.1, 18 a.a. - 256 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • ADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAAT
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 31.57
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-ICOSLG plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00023308-H01

    Western Blot
    QC Testing of H00023308-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Gene Name:
  • ICOSLG
  • Gene Alias:
  • B7-H2,B7H2,B7RP-1,B7RP1,CD275,GL50,ICOS-L,ICOSL,KIAA0653,LICOS
  • Gene Description:
  • inducible T-cell co-stimulator ligand
  • Other Designations:
  • B7-like protein,OTTHUMP00000109524,transmembrane protein B7-H2 ICOS ligand
  • RSS
  • YouTube
  • Linkedin
  • Facebook