UBR2 monoclonal antibody (M01), clone 4G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody (M01), clone 4G4.
Lane 1: UBR2 transfected lysate(50 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBR2 is approximately 0.3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of UBR2 over-expressed 293 cell line, cotransfected with UBR2 Validated Chimera RNAi ( Cat # H00023304-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UBR2 monoclonal antibody (M01), clone 4G4 (Cat # H00023304-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to UBR2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UBR2.
Immunogen
UBR2 (NP_056070, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody (M01), clone 4G4.
Lane 1: UBR2 transfected lysate(50 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBR2 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of UBR2 over-expressed 293 cell line, cotransfected with UBR2 Validated Chimera RNAi ( Cat # H00023304-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UBR2 monoclonal antibody (M01), clone 4G4 (Cat # H00023304-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to UBR2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — UBR2
Entrez GeneID
23304GeneBank Accession#
NM_015255Protein Accession#
NP_056070Gene Name
UBR2
Gene Alias
C6orf133, DKFZp686C08114, KIAA0349, MGC71112, RP3-392M17.3, bA49A4.1, dJ242G1.1, dJ392M17.3
Gene Description
ubiquitin protein ligase E3 component n-recognin 2
Omim ID
609134Gene Ontology
HyperlinkGene Summary
Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognize the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron (Kwon et al., 2003 [PubMed 14585983]).[supplied by OMIM
Other Designations
OTTHUMP00000016403|OTTHUMP00000016405|OTTHUMP00000039767|OTTHUMP00000039768|ubiquitin ligase E3 alpha-II
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com