Product Browser

Last updated: 2017/2/26
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBR2 polyclonal antibody (A01)

  • Catalog # : H00023304-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant UBR2.
  • Immunogen:
  • UBR2 (NP_056070, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023304-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • UBR2
  • Gene Alias:
  • C6orf133,DKFZp686C08114,KIAA0349,MGC71112,RP3-392M17.3,bA49A4.1,dJ242G1.1,dJ392M17.3
  • Gene Description:
  • ubiquitin protein ligase E3 component n-recognin 2
  • Gene Summary:
  • Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognize the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron (Kwon et al., 2003 [PubMed 14585983]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000016403,OTTHUMP00000016405,OTTHUMP00000039767,OTTHUMP00000039768,ubiquitin ligase E3 alpha-II
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook