Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AGTPBP1 polyclonal antibody (A01)

  • Catalog # : H00023287-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AGTPBP1.
  • Immunogen:
  • AGTPBP1 (NP_056054, 1087 a.a. ~ 1186 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023287-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AGTPBP1 expression in transfected 293T cell line by AGTPBP1 polyclonal antibody (A01).

    Lane1:AGTPBP1 transfected lysate(138.448 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • AGTPBP1
  • Gene Alias:
  • DKFZp686M20191,KIAA1035,NNA1
  • Gene Description:
  • ATP/GTP binding protein 1
  • Gene Summary:
  • NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000021581,OTTHUMP00000063553
  • RSS
  • YouTube
  • Linkedin
  • Facebook