Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POFUT2 mouse monoclonal antibody (hybridoma)

  • Catalog # : H00023275-M
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant POFUT2.
  • Immunogen:
  • POFUT2 (NP_598368.2, 1 a.a. ~ 429 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactivity and specificity confirmed by ELISA and Western Blot.
  • Note:
  • Customer should check the viability of the hybridomas within one month from the date of receipt. Fee-for-service of long term hybridoma storage can be performed upon customer's request.
  • Deliverables:
  • Up to 5 positive hybridoma clones will be delivered to customer in the cryotube format.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • POFUT2
  • Gene Alias:
  • C21orf80,FUT13
  • Gene Description:
  • protein O-fucosyltransferase 2
  • Gene Summary:
  • Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).[supplied by OMIM
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook