EXOC7 monoclonal antibody (M01), clone 1D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EXOC7.
Immunogen
EXOC7 (NP_001013861, 586 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EXOC7 monoclonal antibody (M01), clone 1D4 Western Blot analysis of EXOC7 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EXOC7 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EXOC7 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — EXOC7
Entrez GeneID
23265GeneBank Accession#
NM_001013839Protein Accession#
NP_001013861Gene Name
EXOC7
Gene Alias
2-5-3p, DKFZp686J04253, EX070, EXO70, EXOC1, Exo70p, FLJ40965, FLJ46415, YJL085W
Gene Description
exocyst complex component 7
Omim ID
608163Gene Ontology
HyperlinkGene Summary
EXOC7 is a component of the exocyst, which is an evolutionarily conserved octameric protein complex essential for exocytosis. The exocyst targets secretory vesicles at specific domains of the plasma membrane for cell surface expansion and protein secretion (Zuo et al., 2006 [PubMed 17086175]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
EXO70 protein influences dengue virus secretion.
Zhaoni Chen, Xing Lin, Zhiwei Zhang, Jianchun Huang, Shujie Fu, Renbin Huang.
Microbes and Infection 2011 Feb; 13(2):143.
Application:WB-Tr, Human, HepG2 cells.
-
EXO70 protein influences dengue virus secretion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com