Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLCB1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00023236-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PLCB1 partial ORF ( NP_056007, 1107 a.a. - 1216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023236-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PLCB1
  • Gene Alias:
  • FLJ45792,PI-PLC,PLC-154,PLC-I,PLC154
  • Gene Description:
  • phospholipase C, beta 1 (phosphoinositide-specific)
  • Gene Summary:
  • The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. This gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 1,OTTHUMP00000030237,OTTHUMP00000030238,OTTHUMP00000030239,PLC-beta-1,inositoltrisphosphohydrolase,monophosphatidylinositol phosphodiesterase,pho
  • RSS
  • YouTube
  • Linkedin
  • Facebook