Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SYNE2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00023224-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SYNE2 partial ORF ( NP_055995, 6702 a.a. - 6799 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023224-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SYNE2
  • Gene Alias:
  • DKFZp434H2235,DKFZp686E01115,DKFZp686H1931,FLJ11014,FLJ43727,FLJ45710,FLJ46790,KIAA1011,NUA,NUANCE,Nesprin-2,SYNE-2
  • Gene Description:
  • spectrin repeat containing, nuclear envelope 2
  • Gene Summary:
  • The protein encoded by this gene is a nuclear outer membrane protein that binds cytoplasmic F-actin. This binding tethers the nucleus to the cytoskeleton and aids in the maintenance of the structural integrity of the nucleus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • nesprin 2,nucleus and actin connecting element,synaptic nuclei expressed gene 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook