SULF1 (Human) Recombinant Protein (Q02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SULF1 partial ORF ( NP_055985.1, 780 a.a. - 871 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.86
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SULF1
Entrez GeneID
23213GeneBank Accession#
NM_015170Protein Accession#
NP_055985.1Gene Name
SULF1
Gene Alias
FLJ30905, FLJ38022, FLJ41750, HSULF-1, KIAA1077, SULF-1
Gene Description
sulfatase 1
Omim ID
610012Gene Ontology
HyperlinkGene Summary
Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM
Other Designations
sulfatase FP
-
Interactome
-
Disease
-
Publication Reference
-
Role of heparan sulfate 6-0 endosulfatases in intervertebral disc homeostasis.
Otsuki S, Alvarez-Garcia O, Lotz MK, Neo M.
Histology and Histopathology 2019 Mar; 18107.
Application：Func, Mouse, ATDC5 cells.
-
Role of heparan sulfate 6-0 endosulfatases in intervertebral disc homeostasis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com