Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SULF1 monoclonal antibody (M01A), clone 1A4

  • Catalog # : H00023213-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SULF1.
  • Immunogen:
  • SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023213-M01A
    Western Blot detection against Immunogen (35.86 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SULF1
  • Gene Alias:
  • FLJ30905,FLJ38022,FLJ41750,HSULF-1,KIAA1077,SULF-1
  • Gene Description:
  • sulfatase 1
  • Gene Summary:
  • Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM
  • Other Designations:
  • sulfatase FP
  • RSS
  • YouTube
  • Linkedin
  • Facebook