Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NFASC (Human) Recombinant Protein (Q01)

  • Catalog # : H00023114-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NFASC partial ORF ( NP_001005388, 661 a.a. - 758 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023114-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NFASC
  • Gene Alias:
  • DKFZp686P2250,FLJ46866,KIAA0756,NF,NRCAML
  • Gene Description:
  • neurofascin homolog (chicken)
  • Gene Summary:
  • This gene encodes an L1 family immunoglobulin cell adhesion molecule with multiple IGcam and fibronectin domains. The protein functions in neurite outgrowth, neurite fasciculation, and organization of the axon initial segment (AIS) and nodes of Ranvier on axons during early development. Both the AIS and nodes of Ranvier contain high densities of voltage-gated Na+ (Nav) channels which are clustered by interactions with cytoskeletal and scaffolding proteins including this protein, gliomedin, ankyrin 3 (ankyrin-G), and betaIV spectrin. This protein links the AIS extracellular matrix to the intracellular cytoskeleton. This gene undergoes extensive alternative splicing, and the full-length nature of some variants has not been determined
  • Other Designations:
  • OTTHUMP00000065305,OTTHUMP00000065306,OTTHUMP00000065307,OTTHUMP00000065308,OTTHUMP00000065313,OTTHUMP00000065315,OTTHUMP00000065321,OTTHUMP00000065322,OTTHUMP00000065324,neurofascin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook