Product Browser

Last updated: 2017/3/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NFASC polyclonal antibody (A01)

  • Catalog # : H00023114-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NFASC.
  • Immunogen:
  • NFASC (NP_001005388, 661 a.a. ~ 758 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023114-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • NFASC polyclonal antibody (A01), Lot # 060614JCS1 Western Blot analysis of NFASC expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • NFASC
  • Gene Alias:
  • DKFZp686P2250,FLJ46866,KIAA0756,NF,NRCAML
  • Gene Description:
  • neurofascin homolog (chicken)
  • Gene Summary:
  • This gene encodes an L1 family immunoglobulin cell adhesion molecule with multiple IGcam and fibronectin domains. The protein functions in neurite outgrowth, neurite fasciculation, and organization of the axon initial segment (AIS) and nodes of Ranvier on axons during early development. Both the AIS and nodes of Ranvier contain high densities of voltage-gated Na+ (Nav) channels which are clustered by interactions with cytoskeletal and scaffolding proteins including this protein, gliomedin, ankyrin 3 (ankyrin-G), and betaIV spectrin. This protein links the AIS extracellular matrix to the intracellular cytoskeleton. This gene undergoes extensive alternative splicing, and the full-length nature of some variants has not been determined
  • Other Designations:
  • OTTHUMP00000065305,OTTHUMP00000065306,OTTHUMP00000065307,OTTHUMP00000065308,OTTHUMP00000065313,OTTHUMP00000065315,OTTHUMP00000065321,OTTHUMP00000065322,OTTHUMP00000065324,neurofascin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook