Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PARC monoclonal antibody (M01), clone 3F7

  • Catalog # : H00023113-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PARC.
  • Immunogen:
  • PARC (NP_055904, 918 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPSAELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITRLLDF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023113-M01
    Western Blot detection against Immunogen (37.62 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CUL9
  • Gene Alias:
  • DKFZp686G1042,DKFZp686P2024,H7AP1,PARC,RP3-330M21.2
  • Gene Description:
  • cullin 9
  • Other Designations:
  • OTTHUMP00000039816,UbcH7-associated protein 1,p53-associated parkin-like cytoplasmic protein,parkin-like cytoplasmic p53 binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook