Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC2L6 (Human) Recombinant Protein (Q01)

  • Catalog # : H00023097-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDC2L6 partial ORF ( AAH37289, 367 a.a. - 467 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00023097-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CDC2L6
  • Gene Alias:
  • CDK11,KIAA1028,bA346C16.3
  • Gene Description:
  • cell division cycle 2-like 6 (CDK8-like)
  • Gene Summary:
  • This gene encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. [provided by RefSeq
  • Other Designations:
  • CDK8-like cyclin-dependent kinase,OTTHUMP00000017005,OTTHUMP00000040460,cyclin-dependent kinase (CDC2-like) 11,death-preventing kinase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook