TXNDC4 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TXNDC4 protein.
Immunogen
TXNDC4 (NP_055866.1, 1 a.a. ~ 406 a.a) full-length human protein.
Sequence
MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in human liver.Western Blot (Tissue lysate)
TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in human placenta.Western Blot (Tissue lysate)
TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in mouse liver.Western Blot (Cell lysate)
TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in HepG2.Western Blot (Cell lysate)
TXNDC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of TXNDC4 expression in transfected 293T cell line (H00023071-T02) by TXNDC4 MaxPab polyclonal antibody.
Lane 1: TXNDC4 transfected lysate(47.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TXNDC4
Entrez GeneID
23071GeneBank Accession#
NM_015051.1Protein Accession#
NP_055866.1Gene Name
TXNDC4
Gene Alias
ERP44, KIAA0573
Gene Description
thioredoxin domain containing 4 (endoplasmic reticulum)
Omim ID
609170Gene Ontology
HyperlinkOther Designations
OTTHUMP00000021788|OTTHUMP00000063799|endoplasmic reticulum resident protein 44 kDa
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com