ZHX3 monoclonal antibody (M03), clone 1D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZHX3.
Immunogen
ZHX3 (NP_055850.1, 863 a.a. ~ 955 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLET
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (84)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZHX3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZHX3 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — ZHX3
Entrez GeneID
23051GeneBank Accession#
NM_015035Protein Accession#
NP_055850.1Gene Name
ZHX3
Gene Alias
KIAA0395, TIX1
Gene Description
zinc fingers and homeoboxes 3
Omim ID
609598Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor. [provided by RefSeq
Other Designations
OTTHUMP00000031006|triple homeobox 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com