SMG1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SMG1 partial ORF ( NP_055535, 2922 a.a. - 3031 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SMG1
Entrez GeneID
23049GeneBank Accession#
NM_014006Protein Accession#
NP_055535Gene Name
SMG1
Gene Alias
61E3.4, ATX, KIAA0421, LIP
Gene Description
SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans)
Omim ID
607032Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined. [provided by RefSeq
Other Designations
PI-3-kinase-related kinase SMG-1|lambda/iota protein kinase C-interacting protein|phosphatidylinositol 3-kinase-related kinase|phosphatidylinositol 3-kinase-related protein kinase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com