SMG1 monoclonal antibody (M03), clone 1C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMG1.
Immunogen
SMG1 (NP_055535, 2922 a.a. ~ 3031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SMG1 monoclonal antibody (M03), clone 1C12 Western Blot analysis of SMG1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SMG1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMG1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — SMG1
Entrez GeneID
23049GeneBank Accession#
NM_014006Protein Accession#
NP_055535Gene Name
SMG1
Gene Alias
61E3.4, ATX, KIAA0421, LIP
Gene Description
SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans)
Omim ID
607032Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined. [provided by RefSeq
Other Designations
PI-3-kinase-related kinase SMG-1|lambda/iota protein kinase C-interacting protein|phosphatidylinositol 3-kinase-related kinase|phosphatidylinositol 3-kinase-related protein kinase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com