TNIK monoclonal antibody (M01), clone 2D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TNIK monoclonal antibody (M01), clone 2D2. Western Blot analysis of TNIK expression in U-2 OS ( Cat # L022V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M01), clone 2D2.
Lane 1: TNIK transfected lysate(60.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNIK is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TNIK.
Immunogen
TNIK (AAH55427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TNIK monoclonal antibody (M01), clone 2D2. Western Blot analysis of TNIK expression in U-2 OS ( Cat # L022V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M01), clone 2D2.
Lane 1: TNIK transfected lysate(60.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNIK is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — TNIK
Entrez GeneID
23043GeneBank Accession#
BC055427Protein Accession#
AAH55427Gene Name
TNIK
Gene Alias
-
Gene Description
TRAF2 and NCK interacting kinase
Omim ID
610005Gene Ontology
HyperlinkGene Summary
Germinal center kinases (GCKs), such as TNIK, are characterized by an N-terminal kinase domain and a C-terminal GCK domain that serves a regulatory function (Fu et al., 1999 [PubMed 10521462]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com