USP33 monoclonal antibody (M01), clone 5B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of USP33 expression in transfected 293T cell line by USP33 monoclonal antibody (M01), clone 5B5.
Lane 1: USP33 transfected lysate(103.3 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to USP33 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of USP33 transfected lysate using anti-USP33 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with USP33 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP33 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP33 on HeLa cell. [antibody concentration 20 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant USP33.
Immunogen
USP33 (NP_055832, 327 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQIL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of USP33 expression in transfected 293T cell line by USP33 monoclonal antibody (M01), clone 5B5.
Lane 1: USP33 transfected lysate(103.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to USP33 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of USP33 transfected lysate using anti-USP33 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with USP33 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP33 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP33 on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — USP33
Entrez GeneID
23032GeneBank Accession#
NM_015017Protein Accession#
NP_055832Gene Name
USP33
Gene Alias
KIAA1097, MGC16868, VDU1
Gene Description
ubiquitin specific peptidase 33
Gene Ontology
HyperlinkOther Designations
OTTHUMP00000011234|OTTHUMP00000011330|OTTHUMP00000011331|pVHL-interacting deubiquitinating enzyme 1|ubiquitin specific protease 33
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com