Product Browser

Last updated: 2017/12/10
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AOF2 polyclonal antibody (A01)

  • Catalog # : H00023028-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant AOF2.
  • Immunogen:
  • AOF2 (NP_055828, 753 a.a. ~ 851 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00023028-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • AOF2
  • Gene Alias:
  • BHC110,KDM1,KIAA0601,LSD1
  • Gene Description:
  • amine oxidase (flavin containing) domain 2
  • Gene Summary:
  • This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • BRAF35-HDAC complex protein BHC110,FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit,lysine (K)-specific demethylase 1,lysine-specific histone demethylase 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook