Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CNOT1 polyclonal antibody (A01)

  • Catalog # : H00023019-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CNOT1.
  • Immunogen:
  • CNOT1 (NP_057368, 2278 a.a. ~ 2375 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • CNOT1
  • Gene Alias:
  • AD-005,CDC39,DKFZp686E0722,DKFZp686O168,FLJ36492,FLJ90644,KIAA1007,NOT1,NOT1H
  • Gene Description:
  • CCR4-NOT transcription complex, subunit 1
  • Other Designations:
  • NOT1 (negative regulator of transcription 1, yeast) homolog,adrenal gland protein AD-005
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook