DAAM1 monoclonal antibody (M03), clone 4H3

Catalog # H00023002-M03

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

DAAM1 monoclonal antibody (M03), clone 4H3. Western Blot analysis of DAAM1 expression in A-431 ( Cat # L015V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

DAAM1 monoclonal antibody (M03), clone 4H3. Western Blot analysis of DAAM1 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M03), clone 4H3.

Lane 1: DAAM1 transfected lysate(122.3 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged DAAM1 is approximately 1ng/ml as a capture antibody.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between RHOA and DAAM1. HeLa cells were stained with anti-RHOA rabbit purified polyclonal 1:1200 and anti-DAAM1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

QC Test

Western Blot detection against Immunogen (37.84 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant DAAM1.

    Immunogen

    DAAM1 (NP_055807, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL

    Host

    Mouse

    Reactivity

    Human, Rat

    Interspecies Antigen Sequence

    Mouse (97); Rat (99)

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.84 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    DAAM1 monoclonal antibody (M03), clone 4H3. Western Blot analysis of DAAM1 expression in A-431 ( Cat # L015V1 ).

    Western Blot (Cell lysate)

    DAAM1 monoclonal antibody (M03), clone 4H3. Western Blot analysis of DAAM1 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M03), clone 4H3.

    Lane 1: DAAM1 transfected lysate(122.3 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged DAAM1 is approximately 1ng/ml as a capture antibody.

    ELISA

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between RHOA and DAAM1. HeLa cells were stained with anti-RHOA rabbit purified polyclonal 1:1200 and anti-DAAM1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — DAAM1

    Entrez GeneID

    23002

    GeneBank Accession#

    NM_014992

    Protein Accession#

    NP_055807

    Gene Name

    DAAM1

    Gene Alias

    FLJ41657, KIAA0666

    Gene Description

    dishevelled associated activator of morphogenesis 1

    Omim ID

    606626

    Gene Ontology

    Hyperlink

    Gene Summary

    Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. [provided by RefSeq

    Other Designations

    OTTHUMP00000179033|dishevelled-associated activator of morphogenesis 1

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All